Lineage for d4cysb_ (4cys B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138572Family c.76.1.2: Arylsulfatase [53653] (4 protein domains)
    includes additional C-terminal alpha+beta (sub)domain
  6. 2138591Protein automated matches [271610] (1 species)
    not a true protein
  7. 2138592Species Pseudomonas aeruginosa [TaxId:287] [271614] (6 PDB entries)
  8. 2138598Domain d4cysb_: 4cys B: [271885]
    automated match to d1hdha_
    complexed with ca, nh4, peg, sv7; mutant

Details for d4cysb_

PDB Entry: 4cys (more details), 1.88 Å

PDB Description: g6 mutant of pas, arylsulfatase from pseudomonas aeruginosa, in complex with phenylphosphonic acid
PDB Compounds: (B:) arylsulfatase

SCOPe Domain Sequences for d4cysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cysb_ c.76.1.2 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
krpnflvivaddlgfsdigafggeiatpnldalaiaglrltdfhtasaxsptrsmlltgt
dhhiagigtvaealtpelegkpgyeghlnervvalpellreagyqtlmagkwhlglkpeq
tphargfersfsllpgaanhygfeppydestprilkgtpalyvederyldtlpegfyssd
afgdkllqylkerdqsrpffaylpfsaphwplqapreivekyrgrydagpealrqerlar
lkelglveadveahpvlaltrewealedeeraksaramevyaamvermdwnigrvvdylr
rqgeldntfvlfmsdngaegalleafpkfgpdlldfldrhydnslenigsansyvwygpr
waqaatapsrlykafttqggirvpalvryprlsrqgaishafatvmdvtptlldlagvrh
pgkrwrgreiaeprgrswlgwlsgeteaahdentvtgwglfgmrairqgdwkavylpapv
gpatwqlydlardpgeihdladsqpgklaeliehwkryvsdtgvvegaspflvr

SCOPe Domain Coordinates for d4cysb_:

Click to download the PDB-style file with coordinates for d4cysb_.
(The format of our PDB-style files is described here.)

Timeline for d4cysb_: