![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
![]() | Protein automated matches [271870] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [271874] (57 PDB entries) |
![]() | Domain d4c4xa_: 4c4x A: [271883] automated match to d1s8oa2 complexed with w9m |
PDB Entry: 4c4x (more details), 2.17 Å
SCOPe Domain Sequences for d4c4xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c4xa_ c.69.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmk gygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervra vaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasde svlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwk wackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptev nqilikwldsdar
Timeline for d4c4xa_: