Lineage for d4c4xa_ (4c4x A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900441Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2900520Protein automated matches [271870] (2 species)
    not a true protein
  7. 2900526Species Human (Homo sapiens) [TaxId:9606] [271874] (57 PDB entries)
  8. 2900550Domain d4c4xa_: 4c4x A: [271883]
    automated match to d1s8oa2
    complexed with w9m

Details for d4c4xa_

PDB Entry: 4c4x (more details), 2.17 Å

PDB Description: crystal structure of human bifunctional epoxide hydroxylase 2 complexed with c9
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4c4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c4xa_ c.69.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmk
gygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervra
vaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasde
svlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwk
wackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptev
nqilikwldsdar

SCOPe Domain Coordinates for d4c4xa_:

Click to download the PDB-style file with coordinates for d4c4xa_.
(The format of our PDB-style files is described here.)

Timeline for d4c4xa_: