Lineage for d4c4za_ (4c4z A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508005Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2508075Protein automated matches [271870] (2 species)
    not a true protein
  7. 2508081Species Human (Homo sapiens) [TaxId:9606] [271874] (64 PDB entries)
  8. 2508111Domain d4c4za_: 4c4z A: [271880]
    automated match to d1s8oa2
    complexed with w9l

Details for d4c4za_

PDB Entry: 4c4z (more details), 2.06 Å

PDB Description: crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a8
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4c4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c4za_ c.69.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvl
amdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfyp
ervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslf
rasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnm
ernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmd
kptevnqilikwldsdar

SCOPe Domain Coordinates for d4c4za_:

Click to download the PDB-style file with coordinates for d4c4za_.
(The format of our PDB-style files is described here.)

Timeline for d4c4za_: