SCOPe 2.06: Domain d4c4zb_: 4c4z B:

Lineage for d4c4zb_ (4c4z B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein automated matches [271870] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [271874] (57 PDB entries)

8. Domain d4c4zb_: 4c4z B: [271879]
   automated match to d1s8oa2
   complexed with w9l

Details for d4c4zb_

PDB Entry: 4c4z, 2.06 Å

PDB Description: crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a8

PDB Compounds: (B:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d4c4zb_:

Sequence; same for both SEQRES and ATOM records:

>d4c4zb_ c.69.1.11 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvl
amdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfyp
ervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslf
rasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnm
ernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmd
kptevnqilikwldsdar

Timeline for d4c4zb_:

• d4c4zb_ first appeared in SCOPe 2.05
  
• d4c4zb_ appears in SCOPe 2.07
  
• d4c4zb_ appears in the current release, SCOPe 2.08