Lineage for d5aiea1 (5aie A:30-82)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588606Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2588607Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2588608Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2588664Protein automated matches [254608] (2 species)
    not a true protein
  7. 2588665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [271867] (1 PDB entry)
  8. 2588666Domain d5aiea1: 5aie A:30-82 [271868]
    Other proteins in same PDB: d5aiea2, d5aieb1, d5aieb2
    automated match to d1ur6b_
    complexed with zn

Details for d5aiea1

PDB Entry: 5aie (more details), 2.8 Å

PDB Description: not4 ring domain in complex with ubc4
PDB Compounds: (A:) general negative regulator of transcription subunit 4

SCOPe Domain Sequences for d5aiea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aiea1 g.44.1.1 (A:30-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
edycplciepmditdknffpcpcgyqicqfcynnirqnpelngrcpacrrkyd

SCOPe Domain Coordinates for d5aiea1:

Click to download the PDB-style file with coordinates for d5aiea1.
(The format of our PDB-style files is described here.)

Timeline for d5aiea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5aiea2