![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
![]() | Protein automated matches [254608] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [271867] (1 PDB entry) |
![]() | Domain d5aiea1: 5aie A:30-82 [271868] Other proteins in same PDB: d5aiea2, d5aieb1, d5aieb2 automated match to d1ur6b_ complexed with zn |
PDB Entry: 5aie (more details), 2.8 Å
SCOPe Domain Sequences for d5aiea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aiea1 g.44.1.1 (A:30-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} edycplciepmditdknffpcpcgyqicqfcynnirqnpelngrcpacrrkyd
Timeline for d5aiea1: