SCOPe 2.08: Domain d5aiea1: 5aie A:30-82

Lineage for d5aiea1 (5aie A:30-82)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein automated matches [254608] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [271867] (1 PDB entry)

8. Domain d5aiea1: 5aie A:30-82 [271868]
   Other proteins in same PDB: d5aiea2, d5aieb1, d5aieb2
   automated match to d1ur6b_
   complexed with zn

Details for d5aiea1

PDB Entry: 5aie, 2.8 Å

PDB Description: not4 ring domain in complex with ubc4

PDB Compounds: (A:) general negative regulator of transcription subunit 4

SCOPe Domain Sequences for d5aiea1:

Sequence; same for both SEQRES and ATOM records:

>d5aiea1 g.44.1.1 (A:30-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
edycplciepmditdknffpcpcgyqicqfcynnirqnpelngrcpacrrkyd

Timeline for d5aiea1:

• d5aiea1 first appeared in SCOPe 2.05, called d5aiea_
  
• d5aiea1 appears in SCOPe 2.07