SCOPe 2.05: Domain d5aieb_: 5aie B:

Lineage for d5aieb_ (5aie B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197196] (3 PDB entries)

8. Domain d5aieb_: 5aie B: [271866]
   Other proteins in same PDB: d5aiea_
   automated match to d1qcqa_
   complexed with zn

Details for d5aieb_

PDB Entry: 5aie, 2.8 Å

PDB Description: not4 ring domain in complex with ubc4

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 4

SCOPe Domain Sequences for d5aieb_:

Sequence; same for both SEQRES and ATOM records:

>d5aieb_ d.20.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgmssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfp
tdypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpdd
plvpeiahiyktdrpkyeatarewtkkyav

Timeline for d5aieb_:

• d5aieb_ is new in SCOPe 2.05-stable
  
• d5aieb_ is called d5aieb1 in SCOPe 2.06
  
• d5aieb_ appears in the current release, SCOPe 2.08, called d5aieb1