![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197196] (4 PDB entries) |
![]() | Domain d5aieb1: 5aie B:1-148 [271866] Other proteins in same PDB: d5aiea1, d5aiea2, d5aieb2 automated match to d1qcqa_ complexed with zn |
PDB Entry: 5aie (more details), 2.8 Å
SCOPe Domain Sequences for d5aieb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aieb1 d.20.1.1 (B:1-148) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfptd ypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpddpl vpeiahiyktdrpkyeatarewtkkyav
Timeline for d5aieb1: