Lineage for d1adl__ (1adl -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins) 
Protein Adipocyte lipid-binding protein, ALBP [50856] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [50857] (12 PDB entries) 
Domain d1adl__: 1adl - [27186]
Details for d1adl__
PDB Entry: 1adl (more details), 1.6 Å
PDB Description: adipocyte lipid binding protein complexed with arachidonic acid: x-ray crystallographic and titration calorimetry studies
SCOP Domain Sequences for d1adl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adl__ b.60.1.2 (-) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus)}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera
SCOP Domain Coordinates for d1adl__:
Click to download the PDB-style file with coordinates for d1adl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1adl__:
- d1adl__ appears in SCOP 1.57
- d1adl__ appears in the current release, SCOPe 2.08, called d1adla_
View in 3D