Class a: All alpha proteins [46456] (286 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
Protein automated matches [226884] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225065] (5 PDB entries) |
Domain d4z9mh1: 4z9m H:46-137 [271852] Other proteins in same PDB: d4z9ma2, d4z9mb2, d4z9mc2, d4z9md2, d4z9me2, d4z9mf2, d4z9mg2, d4z9mh2 automated match to d1crka1 complexed with adp, unx |
PDB Entry: 4z9m (more details), 2.1 Å
SCOPe Domain Sequences for d4z9mh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9mh1 a.83.1.0 (H:46-137) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfikt vgmvagdeesyevfadlfdpviklrhngydpr
Timeline for d4z9mh1: