Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
Protein automated matches [226885] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225066] (5 PDB entries) |
Domain d4z9me2: 4z9m E:138-415 [271851] Other proteins in same PDB: d4z9ma1, d4z9mb1, d4z9mc1, d4z9md1, d4z9me1, d4z9mf1, d4z9mg1, d4z9mh1 automated match to d1crka2 complexed with adp, unx |
PDB Entry: 4z9m (more details), 2.1 Å
SCOPe Domain Sequences for d4z9me2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9me2 d.128.1.2 (E:138-415) automated matches {Human (Homo sapiens) [TaxId: 9606]} vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig rsevelvqividgvnylvdcekklergqdikvppplpq
Timeline for d4z9me2: