![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
![]() | Protein automated matches [226885] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225066] (4 PDB entries) |
![]() | Domain d4z9mf2: 4z9m F:138-414 [271849] Other proteins in same PDB: d4z9ma1, d4z9mb1, d4z9mc1, d4z9md1, d4z9me1, d4z9mf1, d4z9mg1, d4z9mh1 automated match to d1crka2 complexed with adp, unx |
PDB Entry: 4z9m (more details), 2.1 Å
SCOPe Domain Sequences for d4z9mf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9mf2 d.128.1.2 (F:138-414) automated matches {Human (Homo sapiens) [TaxId: 9606]} vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig rsevelvqividgvnylvdcekklergqdikvppplp
Timeline for d4z9mf2: