SCOPe 2.08: Domain d4z9md1: 4z9m D:42-137

Lineage for d4z9md1 (4z9m D:42-137)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)

8. Domain d4z9md1: 4z9m D:42-137 [271842]
   Other proteins in same PDB: d4z9ma2, d4z9mb2, d4z9mc2, d4z9md2, d4z9me2, d4z9mf2, d4z9mg2, d4z9mh2
   automated match to d1crka1
   complexed with adp, unx

Details for d4z9md1

PDB Entry: 4z9m, 2.1 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase

PDB Compounds: (D:) Creatine kinase S-type, mitochondrial

SCOPe Domain Sequences for d4z9md1:

Sequence; same for both SEQRES and ATOM records:

>d4z9md1 a.83.1.0 (D:42-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
reqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghp
fiktvgmvagdeesyevfadlfdpviklrhngydpr

Timeline for d4z9md1:

• d4z9md1 first appeared in SCOPe 2.05
  
• d4z9md1 appears in SCOPe 2.07