Lineage for d4z9ma2 (4z9m A:138-397)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974955Protein automated matches [226885] (7 species)
    not a true protein
  7. 2974962Species Human (Homo sapiens) [TaxId:9606] [225066] (4 PDB entries)
  8. 2974967Domain d4z9ma2: 4z9m A:138-397 [271841]
    Other proteins in same PDB: d4z9ma1, d4z9mb1, d4z9mc1, d4z9md1, d4z9me1, d4z9mf1, d4z9mg1, d4z9mh1
    automated match to d1crka2
    complexed with adp, unx

Details for d4z9ma2

PDB Entry: 4z9m (more details), 2.1 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase
PDB Compounds: (A:) Creatine kinase S-type, mitochondrial

SCOPe Domain Sequences for d4z9ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9ma2 d.128.1.2 (A:138-397) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale
glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk
tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc
psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig
rsevelvqividgvnylvdc

SCOPe Domain Coordinates for d4z9ma2:

Click to download the PDB-style file with coordinates for d4z9ma2.
(The format of our PDB-style files is described here.)

Timeline for d4z9ma2: