Lineage for d4z9ma1 (4z9m A:46-137)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719300Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2719301Protein automated matches [226884] (9 species)
    not a true protein
  7. 2719308Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)
  8. 2719313Domain d4z9ma1: 4z9m A:46-137 [271840]
    Other proteins in same PDB: d4z9ma2, d4z9mb2, d4z9mc2, d4z9md2, d4z9me2, d4z9mf2, d4z9mg2, d4z9mh2
    automated match to d1crka1
    complexed with adp, unx

Details for d4z9ma1

PDB Entry: 4z9m (more details), 2.1 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase
PDB Compounds: (A:) Creatine kinase S-type, mitochondrial

SCOPe Domain Sequences for d4z9ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9ma1 a.83.1.0 (A:46-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfikt
vgmvagdeesyevfadlfdpviklrhngydpr

SCOPe Domain Coordinates for d4z9ma1:

Click to download the PDB-style file with coordinates for d4z9ma1.
(The format of our PDB-style files is described here.)

Timeline for d4z9ma1: