Lineage for d1lid__ (1lid -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins) 
Protein Adipocyte lipid-binding protein, ALBP [50856] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [50857] (12 PDB entries) 
Domain d1lid__: 1lid - [27184]
Details for d1lid__
PDB Entry: 1lid (more details), 1.6 Å
PDB Description: the adipocyte lipid-binding protein at 1.6 angstroms resolution: crystal structures of the apoprotein and with bound saturated and unsaturated fatty acids
SCOP Domain Sequences for d1lid__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lid__ b.60.1.2 (-) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus)}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera
SCOP Domain Coordinates for d1lid__:
Click to download the PDB-style file with coordinates for d1lid__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lid__:
- d1lid__ appears in SCOP 1.57
- d1lid__ appears in the current release, SCOPe 2.08, called d1lida_
View in 3D