![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
![]() | Protein automated matches [226884] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries) |
![]() | Domain d4z9mc1: 4z9m C:42-137 [271838] Other proteins in same PDB: d4z9ma2, d4z9mb2, d4z9mc2, d4z9md2, d4z9me2, d4z9mf2, d4z9mg2, d4z9mh2 automated match to d1crka1 complexed with adp, unx |
PDB Entry: 4z9m (more details), 2.1 Å
SCOPe Domain Sequences for d4z9mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9mc1 a.83.1.0 (C:42-137) automated matches {Human (Homo sapiens) [TaxId: 9606]} reqprlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghp fiktvgmvagdeesyevfadlfdpviklrhngydpr
Timeline for d4z9mc1: