Lineage for d4ymxb_ (4ymx B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163565Species Caldanaerobacter subterraneus [TaxId:273068] [271830] (1 PDB entry)
  8. 2163567Domain d4ymxb_: 4ymx B: [271833]
    automated match to d3vvfa_
    complexed with arg

Details for d4ymxb_

PDB Entry: 4ymx (more details), 1.48 Å

PDB Description: crystal structure of the substrate binding protein of an amino acid abc transporter
PDB Compounds: (B:) ABC-type amino acid transport system, periplasmic component

SCOPe Domain Sequences for d4ymxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ymxb_ c.94.1.0 (B:) automated matches {Caldanaerobacter subterraneus [TaxId: 273068]}
gvivmgtsadfppfefhkveggkdeivgfdidianaiakklgvkleikdmdfkglipalq
agrvdmviagmtptaerkksvdfsdlyydsrqvvvvkndspiskfddlkvktiavqigtt
seeaakkipnvklkqlnrvsdefmdlqngrcdaivvedtvakaylkeykdmkilymdein
nvengsavavakgnkslldvvnevikelkqsgeydklvdkwfkq

SCOPe Domain Coordinates for d4ymxb_:

Click to download the PDB-style file with coordinates for d4ymxb_.
(The format of our PDB-style files is described here.)

Timeline for d4ymxb_: