SCOPe 2.05: Domain d4ymxb_: 4ymx B:

Lineage for d4ymxb_ (4ymx B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Caldanaerobacter subterraneus [TaxId:273068] [271830] (1 PDB entry)

8. Domain d4ymxb_: 4ymx B: [271833]
   automated match to d3vvfa_
   complexed with arg

Details for d4ymxb_

PDB Entry: 4ymx, 1.48 Å

PDB Description: crystal structure of the substrate binding protein of an amino acid abc transporter

PDB Compounds: (B:) ABC-type amino acid transport system, periplasmic component

SCOPe Domain Sequences for d4ymxb_:

Sequence; same for both SEQRES and ATOM records:

>d4ymxb_ c.94.1.0 (B:) automated matches {Caldanaerobacter subterraneus [TaxId: 273068]}
gvivmgtsadfppfefhkveggkdeivgfdidianaiakklgvkleikdmdfkglipalq
agrvdmviagmtptaerkksvdfsdlyydsrqvvvvkndspiskfddlkvktiavqigtt
seeaakkipnvklkqlnrvsdefmdlqngrcdaivvedtvakaylkeykdmkilymdein
nvengsavavakgnkslldvvnevikelkqsgeydklvdkwfkq

Timeline for d4ymxb_:

• d4ymxb_ is new in SCOPe 2.05-stable
  
• d4ymxb_ appears in SCOPe 2.06
  
• d4ymxb_ appears in the current release, SCOPe 2.08