Lineage for d4ymsa_ (4yms A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871769Species Caldanaerobacter subterraneus [TaxId:273068] [271822] (5 PDB entries)
  8. 2871774Domain d4ymsa_: 4yms A: [271832]
    automated match to d2oukb_

Details for d4ymsa_

PDB Entry: 4yms (more details), 2.8 Å

PDB Description: crystal structure of an amino acid abc transporter
PDB Compounds: (A:) ABC-type polar amino acid transport system, ATPase component

SCOPe Domain Sequences for d4ymsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ymsa_ c.37.1.0 (A:) automated matches {Caldanaerobacter subterraneus [TaxId: 273068]}
mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi
dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl
lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk
qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil

SCOPe Domain Coordinates for d4ymsa_:

Click to download the PDB-style file with coordinates for d4ymsa_.
(The format of our PDB-style files is described here.)

Timeline for d4ymsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ymsj_