Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Caldanaerobacter subterraneus [TaxId:273068] [271822] (5 PDB entries) |
Domain d4ymta_: 4ymt A: [271828] automated match to d2oukb_ complexed with arg |
PDB Entry: 4ymt (more details), 2.6 Å
SCOPe Domain Sequences for d4ymta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ymta_ c.37.1.0 (A:) automated matches {Caldanaerobacter subterraneus [TaxId: 273068]} mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil
Timeline for d4ymta_: