Lineage for d4ymqa1 (4ymq A:265-508)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730040Domain d4ymqa1: 4ymq A:265-508 [271826]
    Other proteins in same PDB: d4ymqa2
    automated match to d1xdkb_
    complexed with gol, na, zbd

Details for d4ymqa1

PDB Entry: 4ymq (more details), 2 Å

PDB Description: x-ray co-structure of nuclear receptor ror-gammat + src2 peptide with a benzothiadiazole dioxide inverse agonist
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4ymqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ymqa1 a.123.1.0 (A:265-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfsg

SCOPe Domain Coordinates for d4ymqa1:

Click to download the PDB-style file with coordinates for d4ymqa1.
(The format of our PDB-style files is described here.)

Timeline for d4ymqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ymqa2