![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
![]() | Protein automated matches [191142] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) |
![]() | Domain d4ymqa1: 4ymq A:265-508 [271826] Other proteins in same PDB: d4ymqa2 automated match to d1xdkb_ complexed with gol, na, zbd |
PDB Entry: 4ymq (more details), 2 Å
SCOPe Domain Sequences for d4ymqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ymqa1 a.123.1.0 (A:265-508) automated matches {Human (Homo sapiens) [TaxId: 9606]} aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke lfsg
Timeline for d4ymqa1: