SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ymtj_ (4ymt J:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (121 species)
    not a true protein
  7. 2114029Species Caldanaerobacter subterraneus [TaxId:273068] [271822] (5 PDB entries)
  8. 2114033Domain d4ymtj_: 4ymt J: [271825]
    automated match to d2oukb_
    complexed with arg

Details for d4ymtj_

PDB Entry: 4ymt (more details), 2.6 Å

PDB Description: crystal structure of an amino acid abc transporter complex with arginines
PDB Compounds: (J:) ABC-type polar amino acid transport system, ATPase component

SCOPe Domain Sequences for d4ymtj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ymtj_ c.37.1.0 (J:) automated matches {Caldanaerobacter subterraneus [TaxId: 273068]}
mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi
dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl
lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk
qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil

SCOPe Domain Coordinates for d4ymtj_:

Click to download the PDB-style file with coordinates for d4ymtj_.
(The format of our PDB-style files is described here.)

Timeline for d4ymtj_: