Lineage for d4ygra_ (4ygr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884225Species Thermococcus onnurineus [TaxId:523850] [271818] (3 PDB entries)
  8. 1884227Domain d4ygra_: 4ygr A: [271821]
    automated match to d1te2a_
    complexed with mg, nhe

Details for d4ygra_

PDB Entry: 4ygr (more details), 1.7 Å

PDB Description: crystal structure of had phosphatase from thermococcus onnurineus
PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d4ygra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ygra_ c.108.1.0 (A:) automated matches {Thermococcus onnurineus [TaxId: 523850]}
mkavlfdidgtilteeplimlflpqvydklsrklgiskdearerflseilgrrdsydwhd
wnfffklfdldlkyeelleryphklqvypdtiptlewlrdtgyklgivtsgpkyqrlklk
ltglldyfdvvitrddvnaikpepkiflytierlgvepgeavmvgdslsqdvygaksvgm
tavwinrngdrgynmadyeirtlyelrkilggerv

SCOPe Domain Coordinates for d4ygra_:

Click to download the PDB-style file with coordinates for d4ygra_.
(The format of our PDB-style files is described here.)

Timeline for d4ygra_:

  • d4ygra_ appears in periodic updates to SCOPe 2.05 starting on 2015-04-23
  • d4ygra_ is called d4ygra1 in SCOPe 2.06
  • d4ygra_ appears in the current release, SCOPe 2.07, called d4ygra1