| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
| Protein automated matches [190447] (55 species) not a true protein |
| Species Thermococcus onnurineus [TaxId:523850] [271818] (3 PDB entries) |
| Domain d4ygra1: 4ygr A:1-214 [271821] Other proteins in same PDB: d4ygra2 automated match to d1te2a_ complexed with mg, nhe |
PDB Entry: 4ygr (more details), 1.7 Å
SCOPe Domain Sequences for d4ygra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ygra1 c.108.1.0 (A:1-214) automated matches {Thermococcus onnurineus [TaxId: 523850]}
mkavlfdidgtilteeplimlflpqvydklsrklgiskdearerflseilgrrdsydwhd
wnfffklfdldlkyeelleryphklqvypdtiptlewlrdtgyklgivtsgpkyqrlklk
ltglldyfdvvitrddvnaikpepkiflytierlgvepgeavmvgdslsqdvygaksvgm
tavwinrngdrgynmadyeirtlyelrkilgger
Timeline for d4ygra1: