SCOPe 2.08: Domain d4ygra1: 4ygr A:1-214

Lineage for d4ygra1 (4ygr A:1-214)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Thermococcus onnurineus [TaxId:523850] [271818] (3 PDB entries)

8. Domain d4ygra1: 4ygr A:1-214 [271821]
   Other proteins in same PDB: d4ygra2
   automated match to d1te2a_
   complexed with mg, nhe

Details for d4ygra1

PDB Entry: 4ygr, 1.7 Å

PDB Description: crystal structure of had phosphatase from thermococcus onnurineus

PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d4ygra1:

Sequence; same for both SEQRES and ATOM records:

>d4ygra1 c.108.1.0 (A:1-214) automated matches {Thermococcus onnurineus [TaxId: 523850]}
mkavlfdidgtilteeplimlflpqvydklsrklgiskdearerflseilgrrdsydwhd
wnfffklfdldlkyeelleryphklqvypdtiptlewlrdtgyklgivtsgpkyqrlklk
ltglldyfdvvitrddvnaikpepkiflytierlgvepgeavmvgdslsqdvygaksvgm
tavwinrngdrgynmadyeirtlyelrkilgger

Timeline for d4ygra1:

• d4ygra1 first appeared in SCOPe 2.05, called d4ygra_
  
• d4ygra1 appears in SCOPe 2.07