Lineage for d4ygqa1 (4ygq A:1-214)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527523Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2527524Protein automated matches [190447] (55 species)
    not a true protein
  7. 2527926Species Thermococcus onnurineus [TaxId:523850] [271818] (3 PDB entries)
  8. 2527929Domain d4ygqa1: 4ygq A:1-214 [271820]
    Other proteins in same PDB: d4ygqa2
    automated match to d1te2a_
    complexed with tbu

Details for d4ygqa1

PDB Entry: 4ygq (more details), 2 Å

PDB Description: crystal structure of had phosphatase from thermococcus onnurineus
PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d4ygqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ygqa1 c.108.1.0 (A:1-214) automated matches {Thermococcus onnurineus [TaxId: 523850]}
mkavlfdidgtilteeplimlflpqvydklsrklgiskdearerflseilgrrdsydwhd
wnfffklfdldlkyeelleryphklqvypdtiptlewlrdtgyklgivtsgpkyqrlklk
ltglldyfdvvitrddvnaikpepkiflytierlgvepgeavmvgdslsqdvygaksvgm
tavwinrngdrgynmadyeirtlyelrkilgger

SCOPe Domain Coordinates for d4ygqa1:

Click to download the PDB-style file with coordinates for d4ygqa1.
(The format of our PDB-style files is described here.)

Timeline for d4ygqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ygqa2