![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Thermococcus onnurineus [TaxId:523850] [271818] (3 PDB entries) |
![]() | Domain d4ygsa1: 4ygs A:1-214 [271819] Other proteins in same PDB: d4ygsa2 automated match to d1te2a_ complexed with cit, mg |
PDB Entry: 4ygs (more details), 1.7 Å
SCOPe Domain Sequences for d4ygsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ygsa1 c.108.1.0 (A:1-214) automated matches {Thermococcus onnurineus [TaxId: 523850]} mkavlfdidgtilteeplimlflpqvydklsrklgiskdearerflseilgrrdsydwhd wnfffklfdldlkyeelleryphklqvypdtiptlewlrdtgyklgivtsgpkyqrlklk ltglldyfdvvitrddvnaikpepkiflytierlgvepgeavmvgdslsqdvygaksvgm tavwinrngdrgynmadyeirtlyelrkilgger
Timeline for d4ygsa1: