SCOPe 2.07: Domain d4xq7a2: 4xq7 A:203-348

Lineage for d4xq7a2 (4xq7 A:203-348)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.0: automated matches [227288] (1 protein)
   not a true family

6. Protein automated matches [227106] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226560] (2 PDB entries)

8. Domain d4xq7a2: 4xq7 A:203-348 [271812]
   Other proteins in same PDB: d4xq7a1
   automated match to d1px5a1

Details for d4xq7a2

PDB Entry: 4xq7, 1.6 Å

PDB Description: the crystal structure of the oas-like domain (old) of human oasl

PDB Compounds: (A:) 2'-5'-oligoadenylate synthase-like protein

SCOPe Domain Sequences for d4xq7a2:

Sequence; same for both SEQRES and ATOM records:

>d4xq7a2 a.160.1.0 (A:203-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptklksllrlvkhwyqqyvkarspranlpplyalelltiyawemgteedenfmldegftt
vmdllleyeviciywtkyytlhnaiiedcvrkqlkkerpiildpadptlnvaegyrwdiv
aqrasqclkqdccydnrenpisswnv

Timeline for d4xq7a2:

• d4xq7a2 first appeared in SCOPe 2.05
  
• d4xq7a2 appears in SCOPe 2.06
  
• d4xq7a2 appears in the current release, SCOPe 2.08