![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins) |
![]() | Protein automated matches [227000] (2 species) not a true protein |
![]() | Species Azotobacter vinelandii [TaxId:322710] [271797] (1 PDB entry) |
![]() | Domain d4xiyd2: 4xiy D:183-328 [271810] Other proteins in same PDB: d4xiya1, d4xiyb1, d4xiyc1, d4xiyd1 automated match to d1np3a1 complexed with fe, mg, peg, pg4, pge |
PDB Entry: 4xiy (more details), 2.5 Å
SCOPe Domain Sequences for d4xiyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xiyd2 a.100.1.2 (D:183-328) automated matches {Azotobacter vinelandii [TaxId: 322710]} fkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfegg ianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanypsmt ayrrnnaahqievvgeklrtmmpwia
Timeline for d4xiyd2: