Lineage for d4xiyd1 (4xiy D:1-182)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829821Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1829997Protein automated matches [226987] (3 species)
    not a true protein
  7. 1829998Species Azotobacter vinelandii [TaxId:322710] [271794] (1 PDB entry)
  8. 1830002Domain d4xiyd1: 4xiy D:1-182 [271809]
    Other proteins in same PDB: d4xiya2, d4xiyb2, d4xiyc2, d4xiyd2
    automated match to d1np3a2
    complexed with fe, mg, peg, pg4, pge

Details for d4xiyd1

PDB Entry: 4xiy (more details), 2.5 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from azotobacter
PDB Compounds: (D:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xiyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xiyd1 c.2.1.6 (D:1-182) automated matches {Azotobacter vinelandii [TaxId: 322710]}
mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
tt

SCOPe Domain Coordinates for d4xiyd1:

Click to download the PDB-style file with coordinates for d4xiyd1.
(The format of our PDB-style files is described here.)

Timeline for d4xiyd1: