Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein automated matches [226987] (3 species) not a true protein |
Species Azotobacter vinelandii [TaxId:322710] [271794] (1 PDB entry) |
Domain d4xiyd1: 4xiy D:1-182 [271809] Other proteins in same PDB: d4xiya2, d4xiyb2, d4xiyc2, d4xiyd2 automated match to d1np3a2 complexed with fe, mg, peg, pg4, pge |
PDB Entry: 4xiy (more details), 2.5 Å
SCOPe Domain Sequences for d4xiyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xiyd1 c.2.1.6 (D:1-182) automated matches {Azotobacter vinelandii [TaxId: 322710]} mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie tt
Timeline for d4xiyd1: