SCOPe 2.05: Domain d4xdzb2: 4xdz B:184-330

Lineage for d4xdzb2 (4xdz B:184-330)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (30 species)
   not a true protein

7. Species Ignisphaera aggregans [TaxId:583356] [271788] (2 PDB entries)

8. Domain d4xdzb2: 4xdz B:184-330 [271808]
   Other proteins in same PDB: d4xdza1, d4xdzb1
   automated match to d1np3a1
   complexed with 40e, epe, gol, mg, ndp

Details for d4xdzb2

PDB Entry: 4xdz, 1.15 Å

PDB Description: holo structure of ketol-acid reductoisomerase from ignisphaera aggregans

PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xdzb2:

Sequence; same for both SEQRES and ATOM records:

>d4xdzb2 a.100.1.0 (B:184-330) automated matches {Ignisphaera aggregans [TaxId: 583356]}
fkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliyekg
ltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmptvf
kelselegstietvgrklremmfrgmk

Timeline for d4xdzb2:

• d4xdzb2 is new in SCOPe 2.05-stable
  
• d4xdzb2 appears in SCOPe 2.06
  
• d4xdzb2 appears in the current release, SCOPe 2.08