| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (239 species) not a true protein |
| Species Ignisphaera aggregans [TaxId:583356] [271786] (3 PDB entries) |
| Domain d4xdzb1: 4xdz B:2-183 [271807] Other proteins in same PDB: d4xdza2, d4xdzb2 automated match to d1np3a2 complexed with 40e, epe, gol, mg, ndp |
PDB Entry: 4xdz (more details), 1.15 Å
SCOPe Domain Sequences for d4xdzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdzb1 c.2.1.0 (B:2-183) automated matches {Ignisphaera aggregans [TaxId: 583356]}
akiykdedislepiknktiailgygsqgrawalnlrdsglnvvvglerqgdswrraiddg
fkpmytkdavaiadiivflvpdmvqkslwlnsvkdfmkkgadlvfahgfnihfkiieppk
dsdvymiapkspgpivrrsyemgggvpalvavyqnvsgealqkalaiakgigcaragvie
st
Timeline for d4xdzb1: