SCOPe 2.06: Domain d4xdzb1: 4xdz B:2-183

Lineage for d4xdzb1 (4xdz B:2-183)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Ignisphaera aggregans [TaxId:583356] [271786] (3 PDB entries)

8. Domain d4xdzb1: 4xdz B:2-183 [271807]
   Other proteins in same PDB: d4xdza2, d4xdzb2
   automated match to d1np3a2
   complexed with 40e, epe, gol, mg, ndp

Details for d4xdzb1

PDB Entry: 4xdz, 1.15 Å

PDB Description: holo structure of ketol-acid reductoisomerase from ignisphaera aggregans

PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xdzb1:

Sequence; same for both SEQRES and ATOM records:

>d4xdzb1 c.2.1.0 (B:2-183) automated matches {Ignisphaera aggregans [TaxId: 583356]}
akiykdedislepiknktiailgygsqgrawalnlrdsglnvvvglerqgdswrraiddg
fkpmytkdavaiadiivflvpdmvqkslwlnsvkdfmkkgadlvfahgfnihfkiieppk
dsdvymiapkspgpivrrsyemgggvpalvavyqnvsgealqkalaiakgigcaragvie
st

Timeline for d4xdzb1:

• d4xdzb1 first appeared in SCOPe 2.05
  
• d4xdzb1 appears in SCOPe 2.07
  
• d4xdzb1 appears in the current release, SCOPe 2.08