SCOPe 2.08: Domain d4xdya2: 4xdy A:188-331

Lineage for d4xdya2 (4xdy A:188-331)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Uncultured archaeon [TaxId:285389] [271799] (1 PDB entry)

8. Domain d4xdya2: 4xdy A:188-331 [271806]
   Other proteins in same PDB: d4xdya1, d4xdyb1
   automated match to d4kqxb2
   complexed with gol, hio, mg, nai

Details for d4xdya2

PDB Entry: 4xdy, 1.54 Å

PDB Description: structure of nadh-preferring ketol-acid reductoisomerase from an uncultured archean

PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xdya2:

Sequence; same for both SEQRES and ATOM records:

>d4xdya2 a.100.1.0 (A:188-331) automated matches {Uncultured archaeon [TaxId: 285389]}
feqetyedlfgeqcvlcgglvelmrngfevlveagyppemayfecvhemklivdlvwqgg
ikrmaevisntaeygmwavghqiigpevkekmkealkrvengefanewvdeykrgipflk
asrekmgehqvetvgaeirklfaq

Timeline for d4xdya2:

• d4xdya2 first appeared in SCOPe 2.05
  
• d4xdya2 appears in SCOPe 2.07