Lineage for d4xdya2 (4xdy A:188-331)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721996Species Uncultured archaeon [TaxId:285389] [271799] (1 PDB entry)
  8. 2721997Domain d4xdya2: 4xdy A:188-331 [271806]
    Other proteins in same PDB: d4xdya1, d4xdyb1
    automated match to d4kqxb2
    complexed with gol, hio, mg, nai

Details for d4xdya2

PDB Entry: 4xdy (more details), 1.54 Å

PDB Description: structure of nadh-preferring ketol-acid reductoisomerase from an uncultured archean
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xdya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdya2 a.100.1.0 (A:188-331) automated matches {Uncultured archaeon [TaxId: 285389]}
feqetyedlfgeqcvlcgglvelmrngfevlveagyppemayfecvhemklivdlvwqgg
ikrmaevisntaeygmwavghqiigpevkekmkealkrvengefanewvdeykrgipflk
asrekmgehqvetvgaeirklfaq

SCOPe Domain Coordinates for d4xdya2:

Click to download the PDB-style file with coordinates for d4xdya2.
(The format of our PDB-style files is described here.)

Timeline for d4xdya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xdya1