Lineage for d4xiyc2 (4xiy C:183-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721358Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)
  6. 2721375Protein automated matches [227000] (2 species)
    not a true protein
  7. 2721376Species Azotobacter vinelandii [TaxId:322710] [271797] (1 PDB entry)
  8. 2721379Domain d4xiyc2: 4xiy C:183-328 [271804]
    Other proteins in same PDB: d4xiya1, d4xiyb1, d4xiyc1, d4xiyd1
    automated match to d1np3a1
    complexed with fe, mg, peg, pg4, pge

Details for d4xiyc2

PDB Entry: 4xiy (more details), 2.5 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from azotobacter
PDB Compounds: (C:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xiyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xiyc2 a.100.1.2 (C:183-328) automated matches {Azotobacter vinelandii [TaxId: 322710]}
fkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfegg
ianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanypsmt
ayrrnnaahqievvgeklrtmmpwia

SCOPe Domain Coordinates for d4xiyc2:

Click to download the PDB-style file with coordinates for d4xiyc2.
(The format of our PDB-style files is described here.)

Timeline for d4xiyc2: