SCOPe 2.08: Domain d4xiyc2: 4xiy C:183-328

Lineage for d4xiyc2 (4xiy C:183-328)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)

6. Protein automated matches [227000] (2 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:322710] [271797] (1 PDB entry)

8. Domain d4xiyc2: 4xiy C:183-328 [271804]
   Other proteins in same PDB: d4xiya1, d4xiyb1, d4xiyc1, d4xiyd1
   automated match to d1np3a1
   complexed with fe, mg, peg, pg4, pge

Details for d4xiyc2

PDB Entry: 4xiy, 2.5 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from azotobacter

PDB Compounds: (C:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xiyc2:

Sequence; same for both SEQRES and ATOM records:

>d4xiyc2 a.100.1.2 (C:183-328) automated matches {Azotobacter vinelandii [TaxId: 322710]}
fkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfegg
ianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanypsmt
ayrrnnaahqievvgeklrtmmpwia

Timeline for d4xiyc2:

• d4xiyc2 first appeared in SCOPe 2.05
  
• d4xiyc2 appears in SCOPe 2.07