SCOPe 2.08: Domain d4xiyc1: 4xiy C:1-182

Lineage for d4xiyc1 (4xiy C:1-182)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein automated matches [226987] (4 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:322710] [271794] (1 PDB entry)

8. Domain d4xiyc1: 4xiy C:1-182 [271803]
   Other proteins in same PDB: d4xiya2, d4xiyb2, d4xiyc2, d4xiyd2
   automated match to d1np3a2
   complexed with fe, mg, peg, pg4, pge

Details for d4xiyc1

PDB Entry: 4xiy, 2.5 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from azotobacter

PDB Compounds: (C:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xiyc1:

Sequence; same for both SEQRES and ATOM records:

>d4xiyc1 c.2.1.6 (C:1-182) automated matches {Azotobacter vinelandii [TaxId: 322710]}
mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
tt

Timeline for d4xiyc1:

• d4xiyc1 first appeared in SCOPe 2.05
  
• d4xiyc1 appears in SCOPe 2.07