Class a: All alpha proteins [46456] (286 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (30 species) not a true protein |
Species Uncultured archaeon [TaxId:285389] [271799] (1 PDB entry) |
Domain d4xdyb2: 4xdy B:188-331 [271800] Other proteins in same PDB: d4xdya1, d4xdyb1 automated match to d4kqxb2 complexed with gol, hio, mg, nai |
PDB Entry: 4xdy (more details), 1.54 Å
SCOPe Domain Sequences for d4xdyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdyb2 a.100.1.0 (B:188-331) automated matches {Uncultured archaeon [TaxId: 285389]} feqetyedlfgeqcvlcgglvelmrngfevlveagyppemayfecvhemklivdlvwqgg ikrmaevisntaeygmwavghqiigpevkekmkealkrvengefanewvdeykrgipflk asrekmgehqvetvgaeirklfaq
Timeline for d4xdyb2: