SCOPe 2.05: Domain d4xdyb1: 4xdy B:1-187

Lineage for d4xdyb1 (4xdy B:1-187)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Uncultured archaeon [TaxId:285389] [271793] (1 PDB entry)

8. Domain d4xdyb1: 4xdy B:1-187 [271796]
   Other proteins in same PDB: d4xdya2, d4xdyb2
   automated match to d4kqxb1
   complexed with gol, hio, mg, nai

Details for d4xdyb1

PDB Entry: 4xdy, 1.54 Å

PDB Description: structure of nadh-preferring ketol-acid reductoisomerase from an uncultured archean

PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xdyb1:

Sequence; same for both SEQRES and ATOM records:

>d4xdyb1 c.2.1.0 (B:1-187) automated matches {Uncultured archaeon [TaxId: 285389]}
meilhdedvddsilrdktiavmgygaqgdaqanclkdsginvvigeteilggnknpswek
akedgfevlpidkaaekgdvvhillpdevqpaiyenqikpqlkagkalcfshgfnicfkr
ivppedvdvimvapkapgteerkaylegfgvpglvavkqnpsgearevalamtkamhwtk
agilect

Timeline for d4xdyb1:

• d4xdyb1 is new in SCOPe 2.05-stable
  
• d4xdyb1 appears in SCOPe 2.06
  
• d4xdyb1 appears in the current release, SCOPe 2.08