Lineage for d4xiyb1 (4xiy B:1-182)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453360Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2453540Protein automated matches [226987] (4 species)
    not a true protein
  7. 2453541Species Azotobacter vinelandii [TaxId:322710] [271794] (1 PDB entry)
  8. 2453543Domain d4xiyb1: 4xiy B:1-182 [271795]
    Other proteins in same PDB: d4xiya2, d4xiyb2, d4xiyc2, d4xiyd2
    automated match to d1np3a2
    complexed with fe, mg, peg, pg4, pge

Details for d4xiyb1

PDB Entry: 4xiy (more details), 2.5 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from azotobacter
PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4xiyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xiyb1 c.2.1.6 (B:1-182) automated matches {Azotobacter vinelandii [TaxId: 322710]}
mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
tt

SCOPe Domain Coordinates for d4xiyb1:

Click to download the PDB-style file with coordinates for d4xiyb1.
(The format of our PDB-style files is described here.)

Timeline for d4xiyb1: