![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Ignisphaera aggregans [TaxId:583356] [271788] (3 PDB entries) |
![]() | Domain d4xeha2: 4xeh A:184-328 [271792] Other proteins in same PDB: d4xeha1 automated match to d1np3a1 |
PDB Entry: 4xeh (more details), 1.39 Å
SCOPe Domain Sequences for d4xeha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xeha2 a.100.1.0 (A:184-328) automated matches {Ignisphaera aggregans [TaxId: 583356]} fkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliyekg ltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmptvf kelselegstietvgrklremmfrg
Timeline for d4xeha2: