Lineage for d4xcta_ (4xct A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1918064Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 1918065Species Human (Homo sapiens) [TaxId:9606] [75497] (15 PDB entries)
  8. 1918066Domain d4xcta_: 4xct A: [271790]
    automated match to d4h3xa_
    complexed with bud, ca, dms, edo, gol, n73, pgo, zn

Details for d4xcta_

PDB Entry: 4xct (more details), 1.3 Å

PDB Description: crystal structure of a hydroxamate based inhibitor arp101 (en73) in complex with the mmp-9 catalytic domain.
PDB Compounds: (A:) Matrix metalloproteinase-9,Matrix metalloproteinase-9

SCOPe Domain Sequences for d4xcta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcta_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv
aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefghal
gldhssvpealmypmyrftegpplhkddvngirhlyg

SCOPe Domain Coordinates for d4xcta_:

Click to download the PDB-style file with coordinates for d4xcta_.
(The format of our PDB-style files is described here.)

Timeline for d4xcta_: