Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Gelatinase B (MMP-9) [75496] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) |
Domain d4xcta_: 4xct A: [271790] automated match to d4h3xa_ complexed with bud, ca, dms, edo, gol, n73, pgo, zn |
PDB Entry: 4xct (more details), 1.3 Å
SCOPe Domain Sequences for d4xcta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xcta_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefghal gldhssvpealmypmyrftegpplhkddvngirhlyg
Timeline for d4xcta_: