SCOPe 2.05: Domain d1urea_: 1ure A:

Lineage for d1urea_ (1ure A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Intestinal fatty acid binding protein [50851] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50852] (12 PDB entries)
   Uniprot P02693

8. Domain d1urea_: 1ure A: [27179]
   complexed with plm

Details for d1urea_

PDB Entry: 1ure

PDB Description: nmr structure of intestinal fatty acid-binding protein complexed with palmitate, 20 structures

PDB Compounds: (A:) intestinal fatty acid-binding protein

SCOPe Domain Sequences for d1urea_:

Sequence; same for both SEQRES and ATOM records:

>d1urea_ b.60.1.2 (A:) Intestinal fatty acid binding protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
gveakrifkke

Timeline for d1urea_:

• d1urea_ first appeared (with stable ids) in SCOP 1.55, called d1ure__
  
• d1urea_ appears in SCOPe 2.04
  
• d1urea_ appears in SCOPe 2.06
  
• d1urea_ appears in the current release, SCOPe 2.08