| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Ignisphaera aggregans [TaxId:583356] [271788] (3 PDB entries) |
| Domain d4xdza2: 4xdz A:184-329 [271789] Other proteins in same PDB: d4xdza1, d4xdzb1 automated match to d1np3a1 complexed with 40e, epe, gol, mg, ndp |
PDB Entry: 4xdz (more details), 1.15 Å
SCOPe Domain Sequences for d4xdza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdza2 a.100.1.0 (A:184-329) automated matches {Ignisphaera aggregans [TaxId: 583356]}
fkeetetdlfgeqvilvggimelikasfetlveegyqpevayfetvnelklivdliyekg
ltgmlravsdtakyggitvgkfiidksvrdkmkivlerirsgefarewikeyergmptvf
kelselegstietvgrklremmfrgm
Timeline for d4xdza2: