SCOPe 2.05: Domain d3x39b_: 3x39 B:

Lineage for d3x39b_ (3x39 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c551 [46660] (5 species)

7. Species Pseudomonas aeruginosa [TaxId:208964] [271783] (1 PDB entry)

8. Domain d3x39b_: 3x39 B: [271784]
   automated match to d451ca_
   complexed with hem

Details for d3x39b_

PDB Entry: 3x39, 1.5 Å

PDB Description: domain-swapped dimer of pseudomonas aeruginosa cytochrome c551

PDB Compounds: (B:) cytochrome c-551

SCOPe Domain Sequences for d3x39b_:

Sequence; same for both SEQRES and ATOM records:

>d3x39b_ a.3.1.1 (B:) Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 208964]}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

Timeline for d3x39b_:

• d3x39b_ is new in SCOPe 2.05-stable
  
• d3x39b_ appears in SCOPe 2.06
  
• d3x39b_ appears in the current release, SCOPe 2.08