Lineage for d3x39b_ (3x39 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690878Protein Cytochrome c551 [46660] (5 species)
  7. 2690904Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271783] (3 PDB entries)
  8. 2690907Domain d3x39b_: 3x39 B: [271784]
    automated match to d451ca_
    complexed with hec

Details for d3x39b_

PDB Entry: 3x39 (more details), 1.5 Å

PDB Description: domain-swapped dimer of pseudomonas aeruginosa cytochrome c551
PDB Compounds: (B:) cytochrome c-551

SCOPe Domain Sequences for d3x39b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x39b_ a.3.1.1 (B:) Cytochrome c551 {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

SCOPe Domain Coordinates for d3x39b_:

Click to download the PDB-style file with coordinates for d3x39b_.
(The format of our PDB-style files is described here.)

Timeline for d3x39b_: