Lineage for d4x16b_ (4x16 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076458Family b.121.6.1: Papovaviridae-like VP [88649] (3 protein domains)
  6. 2076528Protein automated matches [191200] (7 species)
    not a true protein
  7. 2076637Species Jc polyomavirus [TaxId:10632] [270722] (7 PDB entries)
  8. 2076644Domain d4x16b_: 4x16 B: [271751]
    automated match to d4mbzj_
    complexed with edo, gol, k, sia

Details for d4x16b_

PDB Entry: 4x16 (more details), 1.8 Å

PDB Description: jc mad-1 polyomavirus vp1 in complex with gd1a oligosaccharide
PDB Compounds: (B:) Major capsid protein VP1

SCOPe Domain Sequences for d4x16b_:

Sequence, based on SEQRES records: (download)

>d4x16b_ b.121.6.1 (B:) automated matches {Jc polyomavirus [TaxId: 10632]}
vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
riplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhf
fsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpd
ptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmft
nrsgsqqwrglsryfkvqlrkrrvk

Sequence, based on observed residues (ATOM records): (download)

>d4x16b_ b.121.6.1 (B:) automated matches {Jc polyomavirus [TaxId: 10632]}
vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
wrglsryfkvqlrkrrvk

SCOPe Domain Coordinates for d4x16b_:

Click to download the PDB-style file with coordinates for d4x16b_.
(The format of our PDB-style files is described here.)

Timeline for d4x16b_: