Lineage for d4x0zb_ (4x0z B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076458Family b.121.6.1: Papovaviridae-like VP [88649] (3 protein domains)
  6. 2076528Protein automated matches [191200] (7 species)
    not a true protein
  7. 2076606Species Jc polyomavirus type 3 [TaxId:804310] [271736] (6 PDB entries)
  8. 2076613Domain d4x0zb_: 4x0z B: [271738]
    automated match to d4mbzj_
    complexed with bgc, edo, gal, gol, k, nga, sia

Details for d4x0zb_

PDB Entry: 4x0z (more details), 1.85 Å

PDB Description: jc polyomavirus genotype 3 vp1 in complex with gm1 oligosaccharide
PDB Compounds: (B:) Major capsid protein

SCOPe Domain Sequences for d4x0zb_:

Sequence, based on SEQRES records: (download)

>d4x0zb_ b.121.6.1 (B:) automated matches {Jc polyomavirus type 3 [TaxId: 804310]}
vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva
riplpnlnedltcgnilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhf
fsvggealelqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpd
ptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmft
nrsgsqqwrglsryfkvqlrkrrvk

Sequence, based on observed residues (ATOM records): (download)

>d4x0zb_ b.121.6.1 (B:) automated matches {Jc polyomavirus type 3 [TaxId: 804310]}
vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnkdmlpcysva
riplpnlilmweavtlktevigvttlmnvhsngqathdngaakpvqgtsfhffsvggeal
elqgvvfnyrttypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentr
yfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqw
rglsryfkvqlrkrrvk

SCOPe Domain Coordinates for d4x0zb_:

Click to download the PDB-style file with coordinates for d4x0zb_.
(The format of our PDB-style files is described here.)

Timeline for d4x0zb_: