Lineage for d4wv9a1 (4wv9 A:1-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820118Domain d4wv9a1: 4wv9 A:1-207 [271731]
    Other proteins in same PDB: d4wv9a2, d4wv9b2, d4wv9c2, d4wv9d2, d4wv9e2
    automated match to d2wnje_
    complexed with md4

Details for d4wv9a1

PDB Entry: 4wv9 (more details), 2 Å

PDB Description: crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with click chemistry compound (3-exo)- 8,8-dimethyl-3-[4-(pyridin-4-yl)-1h-1,2,3-triazol-1-yl]-8- azoniabicyclo[3.2.1]octane
PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4wv9a1:

Sequence, based on SEQRES records: (download)

>d4wv9a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d4wv9a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwklns
lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls
fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrq
vqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d4wv9a1:

Click to download the PDB-style file with coordinates for d4wv9a1.
(The format of our PDB-style files is described here.)

Timeline for d4wv9a1: