Lineage for d4uixa1 (4uix A:44-168)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707451Domain d4uixa1: 4uix A:44-168 [271714]
    Other proteins in same PDB: d4uixa2, d4uixb2, d4uixc2
    automated match to d2nxba_
    complexed with ca, edo, tvu

Details for d4uixa1

PDB Entry: 4uix (more details), 1.58 Å

PDB Description: n-terminal bromodomain of human brd4 with 7-(3,4-dimethoxyphenyl)-n- (1,1-dioxo-1-thian-4-yl)-5-methyl-4-oxo-4h,5h-thieno-3,2-c-pyridine- 2- carboxamide
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d4uixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uixa1 a.29.2.0 (A:44-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nppppetsnpnkpkrqtnqlqyllrvvlktlwkhkfawpfqqpvdavklnlpdyykiikt
pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine
lptee

SCOPe Domain Coordinates for d4uixa1:

Click to download the PDB-style file with coordinates for d4uixa1.
(The format of our PDB-style files is described here.)

Timeline for d4uixa1: