![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
![]() | Domain d4uixb1: 4uix B:44-167 [271710] Other proteins in same PDB: d4uixa2, d4uixb2, d4uixc2 automated match to d4nrba_ complexed with ca, edo, tvu |
PDB Entry: 4uix (more details), 1.58 Å
SCOPe Domain Sequences for d4uixb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uixb1 a.29.2.0 (B:44-167) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhkfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lpte
Timeline for d4uixb1:
![]() Domains from other chains: (mouse over for more information) d4uixa1, d4uixa2, d4uixc1, d4uixc2 |