Lineage for d4qqla_ (4qql A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779444Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 1779445Protein automated matches [190873] (3 species)
    not a true protein
  7. 1779490Species Mus musculus [TaxId:10090] [271469] (6 PDB entries)
  8. 1779497Domain d4qqla_: 4qql A: [271694]
    automated match to d2ka3a_
    complexed with mg

Details for d4qqla_

PDB Entry: 4qql (more details), 2.39 Å

PDB Description: crystal structure of c1ql3 in p1 space group
PDB Compounds: (A:) Complement C1q-like protein 3

SCOPe Domain Sequences for d4qqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqla_ b.22.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
smwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnkys
tfsgfiiyad

SCOPe Domain Coordinates for d4qqla_:

Click to download the PDB-style file with coordinates for d4qqla_.
(The format of our PDB-style files is described here.)

Timeline for d4qqla_: